China (Mainland)
Amyloid β-Protein (42-1) CAS NO.317366-82-8
- Min.Order: 10 Metric Ton
- Payment Terms: L/C,T/T,Other
- Product Details
Keywords
- Amyloid β-Protein (42-1)
- β-Amyloid (42-1)
- catalogue peptide β-Amyloid (42-1)
Quick Details
- ProName: Amyloid β-Protein (42-1)
- CasNo: 317366-82-8
- Appearance: white to off-white powder
- Application: For research purpose
- DeliveryTime: Available in Stock
- PackAge: bottle
- Port: Any port in China
- ProductionCapacity: Metric Ton/Day
- Purity: 95% 98%
- Storage: -20 degree
- Transportation: By Fedx, ems, dhl
- LimitNum: 10 Metric Ton
Superiority
Peptide Modificaiton:
n-terminal modifications: acetylation，formylation， suc, { ，{pglu}，alloc，stearic acid, etc.
c-terminal modifications：amidation，ester, pna，amc, cmk, etc.
special and non-natural amino acids：{d-ala}... , {abu}, {lys(ac)}, {cys(acm)}, {d-cha}, etc.
linkers & spacers: {mini-peg}, {ahx}, {beta-ala}, {gly},etc.
phosphorylation: {pser}, {ptyr}, {pthr}, {d-pser}, {d-ptyr}, {d-pthr}, etc.
fluorescence/dye labeling: biotin, fitc, 5-fam, dansyl, mca, tmr, lys(biotin), etc.
isotope label: n15 ala, n15 lys, etc.
cyclization : mono/ double/triple disulfide bridge, amide cyclic (end or side chain)
quenched fluorescent peptide:
abz/tyr (3-no2), glu(edans)-nh2, dabcyl/glu(edans)-nh2, etc.
coupling : bsa, klh conjugated peptide for antibody production.
- Purification:
crude, desalted, >70%, >80%, >85%, >90%, >95%, or >98% purity.
Details
| Name | β-Amyloid (42-1) |
| Synonyms | Amyloid β-Protein (42-1) |
| CAS | 317366-82-8 |
| Sequence(3-letter) | H-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH |
| equence(1-letter) | NH2-AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OH |
| M.F. | |
| M.W. | 4514.1 |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |